PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID SapurV1A.1584s0060.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Salix
Family NAC
Protein Properties Length: 681aa    MW: 76927.6 Da    PI: 5.0808
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
SapurV1A.1584s0060.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.71.5e-5561331128
                     NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWka 85 
                             lppGfrFhPtdeelv +yLkkk++++k+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWka
  SapurV1A.1584s0060.1.p   6 LPPGFRFHPTDEELVAYYLKKKINAHKIEL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPRDRKYPNGSRTNRATKAGYWKA 91 
                             79****************************.99***************6434555777***************************** PP

                     NAM  86 tgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                             tgkd++v+s + ++vg+kktLv+y+grap+g +t Wvmheyrl
  SapurV1A.1584s0060.1.p  92 TGKDRKVIS-QMRAVGMKKTLVYYRGRAPHGARTGWVMHEYRL 133
                             *********.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-624155IPR003441NAC domain
PROSITE profilePS5100560.6296156IPR003441NAC domain
PfamPF023651.1E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 681 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKKKINA HKIELEIIPE VDLYKCEPWD LPGKSLLPSK  60
DLEWYFFSPR DRKYPNGSRT NRATKAGYWK ATGKDRKVIS QMRAVGMKKT LVYYRGRAPH  120
GARTGWVMHE YRLDERECET NTGLQDSYAL CRVSKRTTTI PKIGEIYEST TSRVPCEHSS  180
SINEIYSENN GRCEEYESTN YTLHRNVDTC STSYRATGSP LNIGESRNGK WIQSMDGFGT  240
SAPQFPNYST VPYPPSKVDI ALECARLQHR FTLPPLQVDD FPQFGFTDMK VMQQPSMQEC  300
TSTHQTDILQ EILSVAQASQ ELINQSSFQD TWGGNYATAD HDFTFMDGKD VQLNVYSDMM  360
MNSTRWVDKP WFEPSTSSRS IDMSDLDETF KAERMVENLR WVGMSNDELE KSFTEDTKIV  420
PIENISNFRS REEHGVLGEN GQTAGDCMGF NDSEDFSLAF INDEPSDDNF IEESNVDDLA  480
SSPSFEVVEE IKVNHGLFVS TRQATETFFH QLVPSQTVKI YLNPAVVTTN FCIDTAENTQ  540
KYDTKPSTTT AKENFIGSKS SVQNPWRYLA SNIVCMIVIL LMHCFYLGEN VENGNLMDEF  600
MGSGSVEEEG FCPSKNMIKP MKKPSGKLMK RDGNEKEKDL VVTIRGGGGS KLGLFLKKLG  660
LFLTISFALC SILVNHAMAS *
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-53116212171NO APICAL MERISTEM PROTEIN
1ut4_B2e-53116212171NO APICAL MERISTEM PROTEIN
1ut7_A2e-53116212171NO APICAL MERISTEM PROTEIN
1ut7_B2e-53116212171NO APICAL MERISTEM PROTEIN
3swm_A2e-53116215174NAC domain-containing protein 19
3swm_B2e-53116215174NAC domain-containing protein 19
3swm_C2e-53116215174NAC domain-containing protein 19
3swm_D2e-53116215174NAC domain-containing protein 19
3swp_A2e-53116215174NAC domain-containing protein 19
3swp_B2e-53116215174NAC domain-containing protein 19
3swp_C2e-53116215174NAC domain-containing protein 19
3swp_D2e-53116215174NAC domain-containing protein 19
4dul_A2e-53116212171NAC domain-containing protein 19
4dul_B2e-53116212171NAC domain-containing protein 19
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00212DAPTransfer from AT1G65910Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002305903.10.0hypothetical protein POPTR_0004s07910g
TrEMBLB9H3G00.0B9H3G0_POPTR; Uncharacterized protein
STRINGPOPTR_0004s07910.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF44213460
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-154NAC domain containing protein 28